PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Glyma.15G045200.1.p
Common NameGLYMA_15G045200, LOC100798401
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Glycine; Soja
Family LBD
Protein Properties Length: 173aa    MW: 19195.8 Da    PI: 5.7466
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Glyma.15G045200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.12.7e-4231021100
               DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleql 90 
                          +CaaCk+lrr+Ca++Cvlapyfp ++p+kf  +h++FGasn++k+l++lpe++r da++s+vyeA ar+rdPvyG++g i +lq+q+++l
  Glyma.15G045200.1.p   3 PCAACKILRRRCAEKCVLAPYFPLTEPSKFTTAHRVFGASNIIKFLQELPESQRADAVASMVYEAGARIRDPVYGCAGAICQLQKQVNEL 92 
                          7***************************************************************************************** PP

               DUF260  91 kaelallkee 100
                          +a+la++++e
  Glyma.15G045200.1.p  93 QAQLAKAQAE 102
                          ******9976 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.9542103IPR004883Lateral organ boundaries, LOB
PfamPF031953.2E-423100IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 173 aa     Download sequence    Send to blast
MSPCAACKIL RRRCAEKCVL APYFPLTEPS KFTTAHRVFG ASNIIKFLQE LPESQRADAV  60
ASMVYEAGAR IRDPVYGCAG AICQLQKQVN ELQAQLAKAQ AEVVNMQLQQ ANLVALICME  120
MAQTQTPQEY SPQQSVDNFI SSTSHSSGYQ NNLNFFEENT NNLNSLWEPL WT*
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Gma.365591e-119cotyledon| meristem
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankBT0971751e-117BT097175.1 Soybean clone JCVI-FLGm-21N19 unknown mRNA.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006597316.11e-126PREDICTED: LOB domain-containing protein 11-like
SwissprotQ9SK087e-75LBD11_ARATH; LOB domain-containing protein 11
TrEMBLI1MDM71e-126I1MDM7_SOYBN; Uncharacterized protein
STRINGGLYMA15G05030.11e-126(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Representative plantOGRP6016318
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G28500.17e-67LOB domain-containing protein 11